SCOP 1.57: Domain d1n90b1: 1n90 B:5-117

Lineage for d1n90b1 (1n90 B:5-117)

1. Root: SCOP 1.57

2. Class a: All alpha proteins [46456] (144 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (5 families)

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [46674] (8 PDB entries)

8. Domain d1n90b1: 1n90 B:5-117 [15946]
   Other proteins in same PDB: d1n90a2, d1n90b2

Details for d1n90b1

PDB Entry: 1n90, 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1n90b1:

Sequence; same for both SEQRES and ATOM records:

>d1n90b1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

Timeline for d1n90b1:

• d1n90b1 first appeared (with stable ids) in SCOP 1.55
  
• d1n90b1 appears in SCOP 1.59
  
• d1n90b1 appears in the current release, SCOPe 2.08