Lineage for d1n15b1 (1n15 B:5-117)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981215Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 1981216Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 1981243Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)
  8. 1981252Domain d1n15b1: 1n15 B:5-117 [15944]
    Other proteins in same PDB: d1n15a2, d1n15b2
    complexed with dhe, hec

Details for d1n15b1

PDB Entry: 1n15 (more details), 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1n15b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n15b1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOPe Domain Coordinates for d1n15b1:

Click to download the PDB-style file with coordinates for d1n15b1.
(The format of our PDB-style files is described here.)

Timeline for d1n15b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n15b2