Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries) |
Domain d1n15b1: 1n15 B:5-117 [15944] Other proteins in same PDB: d1n15a2, d1n15b2 complexed with dhe, hec |
PDB Entry: 1n15 (more details), 2.9 Å
SCOPe Domain Sequences for d1n15b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1n15b1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp
Timeline for d1n15b1: