Lineage for d1n15a1 (1n15 A:6-117)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45210Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 45211Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 45236Species Pseudomonas aeruginosa [TaxId:287] [46674] (8 PDB entries)
  8. 45242Domain d1n15a1: 1n15 A:6-117 [15943]
    Other proteins in same PDB: d1n15a2, d1n15b2

Details for d1n15a1

PDB Entry: 1n15 (more details), 2.9 Å

PDB Description: following the c heme reduction in nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1n15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n15a1 a.3.1.2 (A:6-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOP Domain Coordinates for d1n15a1:

Click to download the PDB-style file with coordinates for d1n15a1.
(The format of our PDB-style files is described here.)

Timeline for d1n15a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1n15a2