Class a: All alpha proteins [46456] (138 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) |
Superfamily a.3.1: Cytochrome c [46626] (5 families) |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) |
Species Pseudomonas aeruginosa [TaxId:287] [46674] (6 PDB entries) |
Domain d1nnob1: 1nno B:5-117 [15942] Other proteins in same PDB: d1nnoa2, d1nnob2 |
PDB Entry: 1nno (more details), 2.65 Å
SCOP Domain Sequences for d1nnob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nnob1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa} kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp
Timeline for d1nnob1: