Lineage for d1nnoa1 (1nno A:5-117)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45210Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 45211Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 45236Species Pseudomonas aeruginosa [TaxId:287] [46674] (8 PDB entries)
  8. 45240Domain d1nnoa1: 1nno A:5-117 [15941]
    Other proteins in same PDB: d1nnoa2, d1nnob2

Details for d1nnoa1

PDB Entry: 1nno (more details), 2.65 Å

PDB Description: conformational changes occurring upon no binding in nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1nnoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nnoa1 a.3.1.2 (A:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOP Domain Coordinates for d1nnoa1:

Click to download the PDB-style file with coordinates for d1nnoa1.
(The format of our PDB-style files is described here.)

Timeline for d1nnoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nnoa2