SCOP 1.75: Domain d1nirb1: 1nir B:5-117

Lineage for d1nirb1 (1nir B:5-117)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)

8. Domain d1nirb1: 1nir B:5-117 [15940]
   Other proteins in same PDB: d1nira2, d1nirb2
   complexed with cl, dhe, hec, oh, po4

Details for d1nirb1

PDB Entry: 1nir, 2.15 Å

PDB Description: oxydized nitrite reductase from pseudomonas aeruginosa

PDB Compounds: (B:) nitrite reductase

SCOP Domain Sequences for d1nirb1:

Sequence; same for both SEQRES and ATOM records:

>d1nirb1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]}
kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

Timeline for d1nirb1:

• d1nirb1 first appeared (with stable ids) in SCOP 1.55
  
• d1nirb1 appears in SCOP 1.73
  
• d1nirb1 appears in SCOPe 2.01
  
• d1nirb1 appears in the current release, SCOPe 2.08