Lineage for d1nirb1 (1nir B:5-117)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 210127Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 210128Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 210155Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)
  8. 210157Domain d1nirb1: 1nir B:5-117 [15940]
    Other proteins in same PDB: d1nira2, d1nirb2
    complexed with cl, dhe, hec, oh, po4

Details for d1nirb1

PDB Entry: 1nir (more details), 2.15 Å

PDB Description: oxydized nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1nirb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nirb1 a.3.1.2 (B:5-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOP Domain Coordinates for d1nirb1:

Click to download the PDB-style file with coordinates for d1nirb1.
(The format of our PDB-style files is described here.)

Timeline for d1nirb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nirb2