| Class a: All alpha proteins [46456] (171 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
| Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
| Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries) |
| Domain d1nira1: 1nir A:6-117 [15939] Other proteins in same PDB: d1nira2, d1nirb2 |
PDB Entry: 1nir (more details), 2.15 Å
SCOP Domain Sequences for d1nira1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nira1 a.3.1.2 (A:6-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp
Timeline for d1nira1: