Lineage for d1nira1 (1nir A:6-117)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149691Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 149692Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 149717Species Pseudomonas aeruginosa [TaxId:287] [46674] (9 PDB entries)
  8. 149718Domain d1nira1: 1nir A:6-117 [15939]
    Other proteins in same PDB: d1nira2, d1nirb2

Details for d1nira1

PDB Entry: 1nir (more details), 2.15 Å

PDB Description: oxydized nitrite reductase from pseudomonas aeruginosa

SCOP Domain Sequences for d1nira1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nira1 a.3.1.2 (A:6-117) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa}
aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqpp

SCOP Domain Coordinates for d1nira1:

Click to download the PDB-style file with coordinates for d1nira1.
(The format of our PDB-style files is described here.)

Timeline for d1nira1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nira2