SCOP 1.73: Domain d1aofb1: 1aof B:26-133

Lineage for d1aofb1 (1aof B:26-133)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1aofb1: 1aof B:26-133 [15938]
   Other proteins in same PDB: d1aofa2, d1aofb2
   complexed with dhe, hem, so2

Details for d1aofb1

PDB Entry: 1aof, 2 Å

PDB Description: cytochrome cd1 nitrite reductase, reduced form

PDB Compounds: (B:) nitrite reductase

SCOP Domain Sequences for d1aofb1:

Sequence; same for both SEQRES and ATOM records:

>d1aofb1 a.3.1.2 (B:26-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
epsldnlaqqdvaapgapegvtalsdaqyneankiyfercagchgvlrkgatgkaltpdl
trdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyllldpaa

Timeline for d1aofb1:

• d1aofb1 first appeared (with stable ids) in SCOP 1.55
  
• d1aofb1 appears in SCOP 1.71
  
• d1aofb1 appears in SCOP 1.75
  
• d1aofb1 appears in the current release, SCOPe 2.08