Lineage for d1aomb1 (1aom B:9-133)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45210Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 45211Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 45217Species Paracoccus pantotrophus [TaxId:82367] [46673] (10 PDB entries)
  8. 45227Domain d1aomb1: 1aom B:9-133 [15936]
    Other proteins in same PDB: d1aoma1, d1aomb2

Details for d1aomb1

PDB Entry: 1aom (more details), 1.8 Å

PDB Description: substrate and product bound to cytochrome cd1 nitrite reductase

SCOP Domain Sequences for d1aomb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aomb1 a.3.1.2 (B:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
ldpaa

SCOP Domain Coordinates for d1aomb1:

Click to download the PDB-style file with coordinates for d1aomb1.
(The format of our PDB-style files is described here.)

Timeline for d1aomb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aomb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1aoma1