Class a: All alpha proteins [46456] (144 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) |
Superfamily a.3.1: Cytochrome c [46626] (5 families) |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) |
Species Paracoccus pantotrophus [TaxId:82367] [46673] (10 PDB entries) |
Domain d1aomb1: 1aom B:9-133 [15936] Other proteins in same PDB: d1aoma1, d1aomb2 |
PDB Entry: 1aom (more details), 1.8 Å
SCOP Domain Sequences for d1aomb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aomb1 a.3.1.2 (B:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus} dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll ldpaa
Timeline for d1aomb1: