SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1aomb1 (1aom B:9-133)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980368Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980369Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1980816Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 1980817Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
    the C-terminal domain is a 8-bladed beta-propeller
  7. 1980823Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
    formerly Thiosphaera pantotropha
  8. 1980835Domain d1aomb1: 1aom B:9-133 [15936]
    Other proteins in same PDB: d1aoma1, d1aomb2
    complexed with 2no, dhe, hem, no

Details for d1aomb1

PDB Entry: 1aom (more details), 1.8 Å

PDB Description: substrate and product bound to cytochrome cd1 nitrite reductase
PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1aomb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aomb1 a.3.1.2 (B:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll
ldpaa

SCOPe Domain Coordinates for d1aomb1:

Click to download the PDB-style file with coordinates for d1aomb1.
(The format of our PDB-style files is described here.)

Timeline for d1aomb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1aomb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1aoma1