Class a: All alpha proteins [46456] (289 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) covalently-bound heme completes the core |
Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species) the C-terminal domain is a 8-bladed beta-propeller |
Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries) formerly Thiosphaera pantotropha |
Domain d1aoqb1: 1aoq B:9-133 [15935] Other proteins in same PDB: d1aoqa2, d1aoqb2 complexed with 2no, dhe, hem, no |
PDB Entry: 1aoq (more details), 1.8 Å
SCOPe Domain Sequences for d1aoqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aoqb1 a.3.1.2 (B:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} dpaaaledhktrtdnryepsldnlaqqdvaapgapegvtalsdaqyneankiyfercagc hgvlrkgatgkaltpdltrdlgfdylqsfityaspagmpnwgtsgelsaeqvdlmanyll ldpaa
Timeline for d1aoqb1: