![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein) |
![]() | Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (4 species) the C-terminal domain is a 8-bladed beta-propeller |
![]() | Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries) formerly Thiosphaera pantotropha |
![]() | Domain d1hj3b1: 1hj3 B:26-133 [15931] Other proteins in same PDB: d1hj3a2, d1hj3b2 complexed with dhe, gol, hec, oxy, so4 |
PDB Entry: 1hj3 (more details), 1.6 Å
SCOPe Domain Sequences for d1hj3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hj3b1 a.3.1.2 (B:26-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]} epsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdl trdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaa
Timeline for d1hj3b1: