Lineage for d1hj3a1 (1hj3 A:17-133)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 1162Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)
  6. 1163Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
  7. 1169Species Paracoccus pantotrophus [TaxId:82367] [46673] (7 PDB entries)
  8. 1173Domain d1hj3a1: 1hj3 A:17-133 [15930]
    Other proteins in same PDB: d1hj3a2, d1hj3b2

Details for d1hj3a1

PDB Entry: 1hj3 (more details), 1.6 Å

PDB Description: cytochrome cd1 nitrite reductase, dioxygen complex

SCOP Domain Sequences for d1hj3a1:

Sequence, based on SEQRES records: (download)

>d1hj3a1 a.3.1.2 (A:17-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
hktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkga
tgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaa

Sequence, based on observed residues (ATOM records): (download)

>d1hj3a1 a.3.1.2 (A:17-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
hktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkga
tgkaltpdltrdlgfdylqsfitygspagmplsaeqvdlmanyllldpaa

SCOP Domain Coordinates for d1hj3a1:

Click to download the PDB-style file with coordinates for d1hj3a1.
(The format of our PDB-style files is described here.)

Timeline for d1hj3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hj3a2