SCOP 1.71: Domain d1dy7b1: 1dy7 B:32-135

Lineage for d1dy7b1 (1dy7 B:32-135)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (8 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1dy7b1: 1dy7 B:32-135 [15929]
   Other proteins in same PDB: d1dy7a_, d1dy7b2
   complexed with cmo, dhe, gol, hec, so4

Details for d1dy7b1

PDB Entry: 1dy7, 1.6 Å

PDB Description: cytochrome cd1 nitrite reductase, co complex

SCOP Domain Sequences for d1dy7b1:

Sequence; same for both SEQRES and ATOM records:

>d1dy7b1 a.3.1.2 (B:32-135) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
laqqdvaapgapegvsalsdaqyneankiyfercagchgvlrkgatgkaltpdltrdlgf
dylqsfitygspagmpnwgtsgelsaeqvdlmanyllldpaapp

Timeline for d1dy7b1:

• d1dy7b1 first appeared (with stable ids) in SCOP 1.55
  
• d1dy7b1 appears in SCOP 1.69
  
• d1dy7b1 appears in SCOP 1.73
  
• d1dy7b1 appears in the current release, SCOPe 2.08