SCOPe 2.05: Domain d1hj5b1: 1hj5 B:9-133

Lineage for d1hj5b1 (1hj5 B:9-133)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)
   the C-terminal domain is a 8-bladed beta-propeller

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (11 PDB entries)
   formerly Thiosphaera pantotropha

8. Domain d1hj5b1: 1hj5 B:9-133 [15928]
   Other proteins in same PDB: d1hj5a2, d1hj5b2
   complexed with dhe, gol, hec, so4

Details for d1hj5b1

PDB Entry: 1hj5, 1.46 Å

PDB Description: cytochrome cd1 nitrite reductase, reoxidised enzyme

PDB Compounds: (B:) nitrite reductase

SCOPe Domain Sequences for d1hj5b1:

Sequence; same for both SEQRES and ATOM records:

>d1hj5b1 a.3.1.2 (B:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus [TaxId: 82367]}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
ldpaa

Timeline for d1hj5b1:

• d1hj5b1 first appeared (with stable ids) in SCOP 1.55
  
• d1hj5b1 appears in SCOPe 2.04
  
• d1hj5b1 appears in SCOPe 2.06
  
• d1hj5b1 appears in the current release, SCOPe 2.08