SCOP 1.59: Domain d1hj5a1: 1hj5 A:9-133

Lineage for d1hj5a1 (1hj5 A:9-133)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.2: N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46671] (1 protein)

6. Protein N-terminal (heme c) domain of cytochrome cd1-nitrite reductase [46672] (3 species)

7. Species Paracoccus pantotrophus [TaxId:82367] [46673] (10 PDB entries)

8. Domain d1hj5a1: 1hj5 A:9-133 [15927]
   Other proteins in same PDB: d1hj5a2, d1hj5b2

Details for d1hj5a1

PDB Entry: 1hj5, 1.46 Å

PDB Description: cytochrome cd1 nitrite reductase, reoxidised enzyme

SCOP Domain Sequences for d1hj5a1:

Sequence; same for both SEQRES and ATOM records:

>d1hj5a1 a.3.1.2 (A:9-133) N-terminal (heme c) domain of cytochrome cd1-nitrite reductase {Paracoccus pantotrophus}
dpaaaledhktrtdnryepsldnlaqqdvaapgapegvsalsdaqyneankiyfercagc
hgvlrkgatgkaltpdltrdlgfdylqsfitygspagmpnwgtsgelsaeqvdlmanyll
ldpaa

Timeline for d1hj5a1:

• d1hj5a1 first appeared (with stable ids) in SCOP 1.55
  
• d1hj5a1 appears in SCOP 1.57
  
• d1hj5a1 appears in SCOP 1.61
  
• d1hj5a1 appears in the current release, SCOPe 2.08