Lineage for d1diid_ (1dii D:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 633823Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 633824Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 633825Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 634089Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
    the other subunit is a flavoprotein
  7. 634090Species Pseudomonas putida [TaxId:303] [46670] (3 PDB entries)
  8. 634096Domain d1diid_: 1dii D: [15926]
    Other proteins in same PDB: d1diia1, d1diia2, d1diib1, d1diib2

Details for d1diid_

PDB Entry: 1dii (more details), 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution
PDB Compounds: (D:) p-cresol methylhydroxylase

SCOP Domain Sequences for d1diid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diid_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslp

SCOP Domain Coordinates for d1diid_:

Click to download the PDB-style file with coordinates for d1diid_.
(The format of our PDB-style files is described here.)

Timeline for d1diid_: