Lineage for d1diic_ (1dii C:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 277141Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 277142Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 277143Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 277368Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
    the other subunit is a flavoprotein
  7. 277369Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries)
  8. 277372Domain d1diic_: 1dii C: [15925]
    Other proteins in same PDB: d1diia1, d1diia2, d1diib1, d1diib2

Details for d1diic_

PDB Entry: 1dii (more details), 2.5 Å

PDB Description: crystal structure of p-cresol methylhydroxylase at 2.5 a resolution

SCOP Domain Sequences for d1diic_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diic_ a.3.1.1 (C:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslp

SCOP Domain Coordinates for d1diic_:

Click to download the PDB-style file with coordinates for d1diic_.
(The format of our PDB-style files is described here.)

Timeline for d1diic_: