![]() | Class a: All alpha proteins [46456] (171 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (8 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
![]() | Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species) the other subunit is a flavoprotein |
![]() | Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries) |
![]() | Domain d1diic_: 1dii C: [15925] Other proteins in same PDB: d1diia1, d1diia2, d1diib1, d1diib2 |
PDB Entry: 1dii (more details), 2.5 Å
SCOP Domain Sequences for d1diic_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diic_ a.3.1.1 (C:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida} sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde sltqvaeylsslp
Timeline for d1diic_: