Lineage for d1diqd_ (1diq D:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species) Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries) 
Domain d1diqd_: 1diq D: [15924]
Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2
Details for d1diqd_
PDB Entry: 1diq (more details), 2.75 Å
PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound
SCOP Domain Sequences for d1diqd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diqd_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa
SCOP Domain Coordinates for d1diqd_:
Click to download the PDB-style file with coordinates for d1diqd_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1diqd_:
- d1diqd_ appears in SCOP 1.57
- d1diqd_ appears in the current release, SCOPe 2.08
View in 3D
