Lineage for d1diqd_ (1diq D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2691291Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
    the other subunit is a flavoprotein
  7. 2691292Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries)
  8. 2691296Domain d1diqd_: 1diq D: [15924]
    Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2
    complexed with cl, fad, hec, pcr

Details for d1diqd_

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound
PDB Compounds: (D:) p-cresol methylhydroxylase

SCOPe Domain Sequences for d1diqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqd_ a.3.1.1 (D:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

SCOPe Domain Coordinates for d1diqd_:

Click to download the PDB-style file with coordinates for d1diqd_.
(The format of our PDB-style files is described here.)

Timeline for d1diqd_: