![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species) the other subunit is a flavoprotein |
![]() | Species Pseudomonas putida [TaxId:303] [46670] (2 PDB entries) |
![]() | Domain d1diqc_: 1diq C: [15923] Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2 complexed with cl, fad, hem, pcr |
PDB Entry: 1diq (more details), 2.75 Å
SCOPe Domain Sequences for d1diqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1diqc_ a.3.1.1 (C:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]} sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde sltqvaeylsslpa
Timeline for d1diqc_: