Lineage for d1diqc_ (1diq C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760926Protein p-Cresol methylhydroxylase, cytochrome c subunit [46669] (1 species)
    the other subunit is a flavoprotein
  7. 760927Species Pseudomonas putida [TaxId:303] [46670] (3 PDB entries)
  8. 760930Domain d1diqc_: 1diq C: [15923]
    Other proteins in same PDB: d1diqa1, d1diqa2, d1diqb1, d1diqb2

Details for d1diqc_

PDB Entry: 1diq (more details), 2.75 Å

PDB Description: crystal structure of p-cresol methylhydroxylase with substrate bound
PDB Compounds: (C:) p-cresol methylhydroxylase

SCOP Domain Sequences for d1diqc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1diqc_ a.3.1.1 (C:) p-Cresol methylhydroxylase, cytochrome c subunit {Pseudomonas putida [TaxId: 303]}
sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
sltqvaeylsslpa

SCOP Domain Coordinates for d1diqc_:

Click to download the PDB-style file with coordinates for d1diqc_.
(The format of our PDB-style files is described here.)

Timeline for d1diqc_: