Lineage for d1dw2c_ (1dw2 C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1148Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 1149Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 1161Domain d1dw2c_: 1dw2 C: [15922]

Details for d1dw2c_

PDB Entry: 1dw2 (more details), 2.2 Å

PDB Description: structure of the nitric oxide complex of reduced shp, an oxygen binding cytochrome c

SCOP Domain Sequences for d1dw2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw2c_ a.3.1.1 (C:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOP Domain Coordinates for d1dw2c_:

Click to download the PDB-style file with coordinates for d1dw2c_.
(The format of our PDB-style files is described here.)

Timeline for d1dw2c_: