Lineage for d1dw2a_ (1dw2 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45196Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 45197Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 45207Domain d1dw2a_: 1dw2 A: [15920]

Details for d1dw2a_

PDB Entry: 1dw2 (more details), 2.2 Å

PDB Description: structure of the nitric oxide complex of reduced shp, an oxygen binding cytochrome c

SCOP Domain Sequences for d1dw2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw2a_ a.3.1.1 (A:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOP Domain Coordinates for d1dw2a_:

Click to download the PDB-style file with coordinates for d1dw2a_.
(The format of our PDB-style files is described here.)

Timeline for d1dw2a_: