Lineage for d1dw3b_ (1dw3 B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94791Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 94792Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 94800Domain d1dw3b_: 1dw3 B: [15918]

Details for d1dw3b_

PDB Entry: 1dw3 (more details), 2.1 Å

PDB Description: structure of a reduced oxygen binding cytochrome c

SCOP Domain Sequences for d1dw3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw3b_ a.3.1.1 (B:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOP Domain Coordinates for d1dw3b_:

Click to download the PDB-style file with coordinates for d1dw3b_.
(The format of our PDB-style files is described here.)

Timeline for d1dw3b_: