Lineage for d1dw1b_ (1dw1 B:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45196Protein SHP, an oxygen binding cytochrome c [46667] (1 species)
  7. 45197Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries)
  8. 45202Domain d1dw1b_: 1dw1 B: [15915]

Details for d1dw1b_

PDB Entry: 1dw1 (more details), 1.9 Å

PDB Description: structure of the cyanide complex of shp, an oxygen binding cytochrome c

SCOP Domain Sequences for d1dw1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dw1b_ a.3.1.1 (B:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides}
gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg
keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq

SCOP Domain Coordinates for d1dw1b_:

Click to download the PDB-style file with coordinates for d1dw1b_.
(The format of our PDB-style files is described here.)

Timeline for d1dw1b_: