![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein SHP, an oxygen binding cytochrome c [46667] (1 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [46668] (4 PDB entries) |
![]() | Domain d1dw1b_: 1dw1 B: [15915] complexed with cyn, hem |
PDB Entry: 1dw1 (more details), 1.9 Å
SCOPe Domain Sequences for d1dw1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dw1b_ a.3.1.1 (B:) SHP, an oxygen binding cytochrome c {Rhodobacter sphaeroides [TaxId: 1063]} gdtspaqliagyeaaagapadaergralflstqtggkpdtpscttchgadvtragqtrtg keiaplapsatpdrftdsarvekwlgrncnsvigrdctpgekadllawlaaq
Timeline for d1dw1b_: