Lineage for d05c1__ (05c1 -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. Protein Cytochrome c555 [46665] (1 species)
  7. Species Chlorobium thiosulfatophilum [46666] (1 PDB entry)
  8. Domain d05c1__: 05c1 - [15910]

Details for d05c1__

PDB Entry: 05c1 (more details)

PDB Description: electron transport (heme protein)

SCOP Domain Sequences for d05c1__:

Sequence, based on SEQRES records: (download)

>d05c1__ a.3.1.1 (-) Cytochrome c555 {Chlorobium thiosulfatophilum}
ydaaagkatydascamchktgmmgapkvgdkaawaphiakgmnvmvansikgykgtkgmm
pakggnpkltdaqvgnavaymvgqsk

SCOP Domain Coordinates for d05c1__:

Click to download the PDB-style file with coordinates for d05c1__.
(The format of our PDB-style files is described here.)

Timeline for d05c1__: