Lineage for d1gksa_ (1gks A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690878Protein Cytochrome c551 [46660] (5 species)
  7. 2690879Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [46664] (1 PDB entry)
  8. 2690880Domain d1gksa_: 1gks A: [15909]
    complexed with hem

Details for d1gksa_

PDB Entry: 1gks (more details)

PDB Description: ectothiorhodospira halophila cytochrome c551 (reduced), nmr, 37 structures
PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d1gksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gksa_ a.3.1.1 (A:) Cytochrome c551 {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dgesiyingtaptcsschdrgvagapelnapedwadrpssvdelvestlagkgampaydg
radredlvkaieymlstl

SCOPe Domain Coordinates for d1gksa_:

Click to download the PDB-style file with coordinates for d1gksa_.
(The format of our PDB-style files is described here.)

Timeline for d1gksa_: