| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
| Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
| Protein Cytochrome c551 [46660] (5 species) |
| Species Methylophilus methylotrophus, strain w3a1 [TaxId:17] [46664] (1 PDB entry) |
| Domain d1gksa_: 1gks A: [15909] complexed with hem |
PDB Entry: 1gks (more details)
SCOPe Domain Sequences for d1gksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gksa_ a.3.1.1 (A:) Cytochrome c551 {Methylophilus methylotrophus, strain w3a1 [TaxId: 17]}
dgesiyingtaptcsschdrgvagapelnapedwadrpssvdelvestlagkgampaydg
radredlvkaieymlstl
Timeline for d1gksa_: