Lineage for d2mtac_ (2mta C:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209924Protein Cytochrome c551 [46660] (4 species)
  7. 209927Species Paracoccus denitrificans [TaxId:266] [46663] (3 PDB entries)
  8. 209932Domain d2mtac_: 2mta C: [15908]
    Other proteins in same PDB: d2mtaa_, d2mtah_, d2mtal_
    complexed with cu, hem, owq, po4

Details for d2mtac_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
PDB Compounds: (C:)

SCOP Domain Sequences for d2mtac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtac_ a.3.1.1 (C:) Cytochrome c551 {Paracoccus denitrificans}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d2mtac_:

Click to download the PDB-style file with coordinates for d2mtac_.
(The format of our PDB-style files is described here.)

Timeline for d2mtac_: