Lineage for d2mtac_ (2mta C:)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 149460Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 149461Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 149462Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 149508Protein Cytochrome c551 [46660] (4 species)
  7. 149511Species Paracoccus denitrificans [TaxId:266] [46663] (1 PDB entry)
  8. 149512Domain d2mtac_: 2mta C: [15908]
    Other proteins in same PDB: d2mtaa_, d2mtah_, d2mtal_

Details for d2mtac_

PDB Entry: 2mta (more details), 2.4 Å

PDB Description: crystal structure of a ternary electron transfer complex between methylamine dehydrogenase, amicyanin and a c-type cytochrome
PDB Compounds: (C:)

SCOP Domain Sequences for d2mtac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mtac_ a.3.1.1 (C:) Cytochrome c551 {Paracoccus denitrificans}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d2mtac_:

Click to download the PDB-style file with coordinates for d2mtac_.
(The format of our PDB-style files is described here.)

Timeline for d2mtac_: