Lineage for d2paca_ (2pac A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2304254Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2304334Protein Cytochrome c551 [46660] (5 species)
  7. 2304355Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries)
  8. 2304359Domain d2paca_: 2pac A: [15907]
    complexed with hem

Details for d2paca_

PDB Entry: 2pac (more details)

PDB Description: solution structure of fe(ii) cytochrome c551 from pseudomonas aeruginosa as determined by two-dimensional 1h nmr
PDB Compounds: (A:) cytochrome c551

SCOPe Domain Sequences for d2paca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2paca_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 287]}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOPe Domain Coordinates for d2paca_:

Click to download the PDB-style file with coordinates for d2paca_.
(The format of our PDB-style files is described here.)

Timeline for d2paca_: