Lineage for d351c__ (351c -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1015Protein Cytochrome c551 [46660] (4 species)
  7. 1020Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries)
  8. 1022Domain d351c__: 351c - [15905]

Details for d351c__

PDB Entry: 351c (more details), 1.6 Å

PDB Description: structure of cytochrome c551 from p. aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms

SCOP Domain Sequences for d351c__:

Sequence; same for both SEQRES and ATOM records: (download)

>d351c__ a.3.1.1 (-) Cytochrome c551 {Pseudomonas aeruginosa}
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

SCOP Domain Coordinates for d351c__:

Click to download the PDB-style file with coordinates for d351c__.
(The format of our PDB-style files is described here.)

Timeline for d351c__: