![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c551 [46660] (5 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [46662] (4 PDB entries) |
![]() | Domain d351ca_: 351c A: [15905] complexed with hem |
PDB Entry: 351c (more details), 1.6 Å
SCOPe Domain Sequences for d351ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d351ca_ a.3.1.1 (A:) Cytochrome c551 {Pseudomonas aeruginosa [TaxId: 287]} edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaelaqrikngsqgvwgpip mppnavsddeaqtlakwvlsqk
Timeline for d351ca_: