Class a: All alpha proteins [46456] (171 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
Protein Cytochrome c551 [46660] (4 species) |
Species Pseudomonas stutzeri [TaxId:316] [46661] (3 PDB entries) |
Domain d1cch__: 1cch - [15902] complexed with hem |
PDB Entry: 1cch (more details)
SCOP Domain Sequences for d1cch__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cch__ a.3.1.1 (-) Cytochrome c551 {Pseudomonas stutzeri} qdgealfkskpcaachsvdtkmvgpalkevaaknagvegaadtlalhikngsqgvwgpip mppnpvteeeakilaewvlslk
Timeline for d1cch__: