SCOPe 2.07: Domain d1cc5a_: 1cc5 A:

Lineage for d1cc5a_ (1cc5 A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c5 [46658] (1 species)

7. Species Azotobacter vinelandii [TaxId:354] [46659] (1 PDB entry)

8. Domain d1cc5a_: 1cc5 A: [15901]
   complexed with hem

Details for d1cc5a_

PDB Entry: 1cc5, 2.5 Å

PDB Description: crystal structure of azotobacter cytochrome c5 at 2.5 angstroms resolution

PDB Compounds: (A:) cytochrome c5

SCOPe Domain Sequences for d1cc5a_:

Sequence; same for both SEQRES and ATOM records:

>d1cc5a_ a.3.1.1 (A:) Cytochrome c5 {Azotobacter vinelandii [TaxId: 354]}
gggarsgddvvakycnachgtgllnapkvgdsaawktradakggldgllaqslsglnamp
pkgtcadcsddelkaaigkmsgl

Timeline for d1cc5a_:

• d1cc5a_ first appeared (with stable ids) in SCOP 1.55, called d1cc5__
  
• d1cc5a_ appears in SCOPe 2.06
  
• d1cc5a_ appears in the current release, SCOPe 2.08