Lineage for d1cc5__ (1cc5 -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 985Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 986Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 987Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins)
  6. 1012Protein Cytochrome c5 [46658] (1 species)
  7. 1013Species Azotobacter vinelandii [TaxId:354] [46659] (1 PDB entry)
  8. 1014Domain d1cc5__: 1cc5 - [15901]

Details for d1cc5__

PDB Entry: 1cc5 (more details), 2.5 Å

PDB Description: crystal structure of azotobacter cytochrome c5 at 2.5 angstroms resolution

SCOP Domain Sequences for d1cc5__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cc5__ a.3.1.1 (-) Cytochrome c5 {Azotobacter vinelandii}
gggarsgddvvakycnachgtgllnapkvgdsaawktradakggldgllaqslsglnamp
pkgtcadcsddelkaaigkmsgl

SCOP Domain Coordinates for d1cc5__:

Click to download the PDB-style file with coordinates for d1cc5__.
(The format of our PDB-style files is described here.)

Timeline for d1cc5__: