Lineage for d155c__ (155c -)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 209874Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 209875Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 209876Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins)
  6. 209882Protein Cytochrome c2 [46650] (8 species)
  7. 209883Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries)
  8. 209885Domain d155c__: 155c - [15900]
    complexed with hem

Details for d155c__

PDB Entry: 155c (more details), 2.5 Å

PDB Description: the structure of paracoccus denitrificans cytochrome c550

SCOP Domain Sequences for d155c__:

Sequence; same for both SEQRES and ATOM records: (download)

>d155c__ a.3.1.1 (-) Cytochrome c2 {Paracoccus denitrificans}
negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd
axxxxxxxxxxxxx

SCOP Domain Coordinates for d155c__:

Click to download the PDB-style file with coordinates for d155c__.
(The format of our PDB-style files is described here.)

Timeline for d155c__: