Class a: All alpha proteins [46456] (171 folds) |
Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
Superfamily a.3.1: Cytochrome c [46626] (8 families) covalently-bound heme completes the core |
Family a.3.1.1: monodomain cytochrome c [46627] (14 proteins) |
Protein Cytochrome c2 [46650] (8 species) |
Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries) |
Domain d155c__: 155c - [15900] complexed with hem |
PDB Entry: 155c (more details), 2.5 Å
SCOP Domain Sequences for d155c__:
Sequence; same for both SEQRES and ATOM records: (download)
>d155c__ a.3.1.1 (-) Cytochrome c2 {Paracoccus denitrificans} negdaakgekefnkckachmiqapdgtdikggktgpnlygvvgrkiaseegfkygegile vaeknpdltwteanlieyvtdpkplvkkmtddkgaktkmtfkmgknqadvvaflaqddpd axxxxxxxxxxxxx
Timeline for d155c__: