Lineage for d1cot__ (1cot -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45014Protein Cytochrome c2 [46650] (7 species)
  7. 45015Species Paracoccus denitrificans [TaxId:266] [46657] (2 PDB entries)
  8. 45016Domain d1cot__: 1cot - [15899]

Details for d1cot__

PDB Entry: 1cot (more details), 1.7 Å

PDB Description: x-ray structure of the cytochrome c2 isolated from paracoccus denitrificans refined to 1.7 angstroms resolution

SCOP Domain Sequences for d1cot__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cot__ a.3.1.1 (-) Cytochrome c2 {Paracoccus denitrificans}
dgdaakgekefnkckachmiqapdgtdiikggktgpnlygvvgrkiaseegfkygegile
vaeknpdltwteadlieyvtdpkpwlvkmtddkgaktkmtfkmgknqadvvaflaqnspd
a

SCOP Domain Coordinates for d1cot__:

Click to download the PDB-style file with coordinates for d1cot__.
(The format of our PDB-style files is described here.)

Timeline for d1cot__: