Lineage for d1hrob_ (1hro B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 94589Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 94590Superfamily a.3.1: Cytochrome c [46626] (7 families) (S)
  5. 94591Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)
  6. 94595Protein Cytochrome c2 [46650] (8 species)
  7. 94608Species Rhodopila globiformis [TaxId:1071] [46656] (1 PDB entry)
  8. 94610Domain d1hrob_: 1hro B: [15898]

Details for d1hrob_

PDB Entry: 1hro (more details), 2.2 Å

PDB Description: molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis

SCOP Domain Sequences for d1hrob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrob_ a.3.1.1 (B:) Cytochrome c2 {Rhodopila globiformis}
sappgdpvegkhlfhticitchtdikgankvgpslygvvgrhsgiepgynyseaniksgi
vwtpdvlfkyiehpqkivpgtkmgypgqpdpqkradiiayletlk

SCOP Domain Coordinates for d1hrob_:

Click to download the PDB-style file with coordinates for d1hrob_.
(The format of our PDB-style files is described here.)

Timeline for d1hrob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hroa_