Lineage for d1hrob_ (1hro B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690809Protein Cytochrome c2 [46650] (8 species)
  7. 2690827Species Rhodopila globiformis [TaxId:1071] [46656] (1 PDB entry)
  8. 2690829Domain d1hrob_: 1hro B: [15898]
    complexed with hem

Details for d1hrob_

PDB Entry: 1hro (more details), 2.2 Å

PDB Description: molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis
PDB Compounds: (B:) cytochrome c2

SCOPe Domain Sequences for d1hrob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hrob_ a.3.1.1 (B:) Cytochrome c2 {Rhodopila globiformis [TaxId: 1071]}
sappgdpvegkhlfhticitchtdikgankvgpslygvvgrhsgiepgynyseaniksgi
vwtpdvlfkyiehpqkivpgtkmgypgqpdpqkradiiayletlk

SCOPe Domain Coordinates for d1hrob_:

Click to download the PDB-style file with coordinates for d1hrob_.
(The format of our PDB-style files is described here.)

Timeline for d1hrob_: