Lineage for d1hroa_ (1hro A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45014Protein Cytochrome c2 [46650] (7 species)
  7. 45027Species Rhodopila globiformis [TaxId:1071] [46656] (1 PDB entry)
  8. 45028Domain d1hroa_: 1hro A: [15897]

Details for d1hroa_

PDB Entry: 1hro (more details), 2.2 Å

PDB Description: molecular structure of a high potential cytochrome c2 isolated from rhodopila globiformis

SCOP Domain Sequences for d1hroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hroa_ a.3.1.1 (A:) Cytochrome c2 {Rhodopila globiformis}
sappgdpvegkhlfhticitchtdikgankvgpslygvvgrhsgiepgynyseaniksgi
vwtpdvlfkyiehpqkivpgtkmgypgqpdpqkradiiayletlk

SCOP Domain Coordinates for d1hroa_:

Click to download the PDB-style file with coordinates for d1hroa_.
(The format of our PDB-style files is described here.)

Timeline for d1hroa_: