Lineage for d1hh7a_ (1hh7 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 45011Fold a.3: Cytochrome c [46625] (1 superfamily)
  4. 45012Superfamily a.3.1: Cytochrome c [46626] (5 families) (S)
  5. 45013Family a.3.1.1: monodomain cytochrome c [46627] (11 proteins)
  6. 45014Protein Cytochrome c2 [46650] (7 species)
  7. 45030Species Rhodopseudomonas palustris [TaxId:1076] [46655] (3 PDB entries)
  8. 45032Domain d1hh7a_: 1hh7 A: [15896]

Details for d1hh7a_

PDB Entry: 1hh7 (more details), 1.4 Å

PDB Description: refined crystal structure of cytochrome c2 from rhodopseudomonas palustris at 1.4 angstrom resolution

SCOP Domain Sequences for d1hh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hh7a_ a.3.1.1 (A:) Cytochrome c2 {Rhodopseudomonas palustris}
edakageavfkqcmtchradknmvgpalagvvgrkagtaagftysplnhnsgeaglvwta
dnivpyladpnaflkkfltekgkadqavgvtkmtfklaneqqrkdvvaylatlk

SCOP Domain Coordinates for d1hh7a_:

Click to download the PDB-style file with coordinates for d1hh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1hh7a_: