SCOP 1.59: Domain d1cxa__: 1cxa -

Lineage for d1cxa__ (1cxa -)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)

4. Superfamily a.3.1: Cytochrome c [46626] (7 families)

5. Family a.3.1.1: monodomain cytochrome c [46627] (13 proteins)

6. Protein Cytochrome c2 [46650] (8 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [46653] (3 PDB entries)

8. Domain d1cxa__: 1cxa - [15893]

Details for d1cxa__

PDB Entry: 1cxa, 2.2 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms

SCOP Domain Sequences for d1cxa__:

Sequence; same for both SEQRES and ATOM records:

>d1cxa__ a.3.1.1 (-) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

Timeline for d1cxa__:

• d1cxa__ first appeared (with stable ids) in SCOP 1.55
  
• d1cxa__ appears in SCOP 1.57
  
• d1cxa__ appears in SCOP 1.61
  
• d1cxa__ appears in the current release, SCOPe 2.08, called d1cxaa_