Lineage for d1cxa__ (1cxa -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily) Superfamily a.3.1: Cytochrome c [46626] (5 families) 
Family a.3.1.1: monodomain cytochrome c [46627] (10 proteins) 
Protein Cytochrome c2 [46650] (7 species) 
Species Rhodobacter sphaeroides [TaxId:1063] [46653] (3 PDB entries) 
Domain d1cxa__: 1cxa - [15893]
Details for d1cxa__
PDB Entry: 1cxa (more details), 2.2 Å
PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms
SCOP Domain Sequences for d1cxa__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cxa__ a.3.1.1 (-) Cytochrome c2 {Rhodobacter sphaeroides}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp
SCOP Domain Coordinates for d1cxa__:
Click to download the PDB-style file with coordinates for d1cxa__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cxa__:
- d1cxa__ appears in SCOP 1.57
- d1cxa__ appears in the current release, SCOPe 2.08, called d1cxaa_
View in 3D