Lineage for d1cxaa_ (1cxa A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690809Protein Cytochrome c2 [46650] (8 species)
  7. 2690819Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 2690824Domain d1cxaa_: 1cxa A: [15893]
    complexed with hec, imd

Details for d1cxaa_

PDB Entry: 1cxa (more details), 2.2 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms
PDB Compounds: (A:) cytochrome c2

SCOPe Domain Sequences for d1cxaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxaa_ a.3.1.1 (A:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
qegdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygeg
mkeagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqv
avrp

SCOPe Domain Coordinates for d1cxaa_:

Click to download the PDB-style file with coordinates for d1cxaa_.
(The format of our PDB-style files is described here.)

Timeline for d1cxaa_: