![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.3: Cytochrome c [46625] (1 superfamily) core: 3 helices; folded leaf, opened |
![]() | Superfamily a.3.1: Cytochrome c [46626] (9 families) ![]() covalently-bound heme completes the core |
![]() | Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins) |
![]() | Protein Cytochrome c2 [46650] (8 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries) |
![]() | Domain d2cxbb_: 2cxb B: [15892] complexed with hec |
PDB Entry: 2cxb (more details), 1.95 Å
SCOPe Domain Sequences for d2cxbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cxbb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]} egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva vrp
Timeline for d2cxbb_: