Lineage for d2cxbb_ (2cxb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690809Protein Cytochrome c2 [46650] (8 species)
  7. 2690819Species Rhodobacter sphaeroides [TaxId:1063] [46653] (5 PDB entries)
  8. 2690822Domain d2cxbb_: 2cxb B: [15892]
    complexed with hec

Details for d2cxbb_

PDB Entry: 2cxb (more details), 1.95 Å

PDB Description: crystallization and x-ray structure determination of cytochrome c2 from rhodobacter sphaeroides in three crystal forms
PDB Compounds: (B:) cytochrome c2

SCOPe Domain Sequences for d2cxbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cxbb_ a.3.1.1 (B:) Cytochrome c2 {Rhodobacter sphaeroides [TaxId: 1063]}
egdpeagakafnqcqtchvivddsgttiagrnaktgpnlygvvgrtagtqadfkgygegm
keagakglawdeehfvqyvqdptkflkeytgdakakgkmtfklkkeadahniwaylqqva
vrp

SCOPe Domain Coordinates for d2cxbb_:

Click to download the PDB-style file with coordinates for d2cxbb_.
(The format of our PDB-style files is described here.)

Timeline for d2cxbb_: